Skip to word lists
Science of Reading

Vowel Team Words for Kids

Vowel team words are words where two vowels work together to make one sound: /ai/ as in rain, /ea/ as in read, /oa/ as in boat, /oo/ as in moon. Vowel teams appear in thousands of common words, making them essential for reading fluency. They follow the Science of Reading sequence after silent E, typically introduced in first through second grade.

LUCA's LUCADictionary contains 763,000+ grapheme-phoneme mappings, one of the most comprehensive phonics databases in K-12 education, built on U.S. Patent No. 12,394,332 B2 and validated by NSF SBIR funding that only 3% of applicants receive.

9 patterns · 4,900/mo monthly searches · Last updated: April 2026

Vowel Teams Word Lists

Example Vowel Teams Words

Here are sample words across all vowel teams patterns. Each word follows Science of Reading phonics scope and sequence. Browse a specific pattern above for the complete word list.

paintrainwaitbraidclaimmaypayrayhaywayspeakeachmeatbeardcheapseekpeekweekcheeksleektoedoefoetoesgoesslowknowrowglowflow+15 more

How LUCA Builds Vowel Teams Fluency

Word lists are a starting point. SoundScout's phoneme-level speech recognition listens to children read vowel teams words aloud and identifies exactly which sounds cause difficulty. Then StoryGen generates personalized stories targeting those gaps, and JourneyBuilder sequences the practice in the right order.

This is the LUCALabs cycle: Listen, Analyze, Build. It turns static word lists into adaptive, personalized reading intervention. Every session produces data visible in EducatorHub for teachers and FamilyHub for parents.

LUCALabs

How LUCA Turns Word Lists Into Real Progress

Every read-aloud session runs through the LUCALabs three-phase cycle so gaps for vowel teams words are caught and closed.

SoundScout

Listens

Powered by SoundScout

Captures every phoneme your child produces during read-aloud practice.

Assessment Intelligence

Analyzes

Assessment Intelligence

Identifies exact gaps without a separate test. 763,000+ mappings reveal each reader's needs.

StoryGen

Builds

StoryGen + JourneyBuilder

Generates personalized stories matched to your child's interests and skill level.

Proven Classroom Results

rocket blue
+17.2WPM
Average fluency gain
target gold
72%
Reached mastery threshold
abc blocks purple
763K+
Grapheme-phoneme mappings

From LUCA's classroom evidence · Live results dashboard

National Science Foundation SBIRCarnegie Mellon UniversityUnited States Patent and Trademark OfficeNewSchools Venture FundProvident Charter SchoolNew Kensington-Arnold School DistrictSXSW EDU

Frequently Asked Questions

Frequently Asked Questions

AI vowel team words contain the two-vowel combination AI, which together makes the long A sound (/a/) as in 'rain' and 'tail.' AI is one of the most common spellings of long A and typically appears in the middle of words rather than at the end.

AY vowel team words contain the two-letter combination AY, which makes the long A sound (/a/) as in 'day' and 'play.' AY is the most common spelling of long A at the end of words or syllables.

EA vowel team words contain the two-vowel combination EA, which most commonly makes the long E sound (/e/) as in 'bean' and 'teach.' In some words, EA makes the short E sound (head, bread), which requires explicit teaching of exceptions.

EE vowel team words contain the two-vowel combination EE, which consistently makes the long E sound (/e/) as in 'tree' and 'sleep.' EE is one of the most regular vowel team patterns in English, with very few exceptions.

Turn vowel teams word lists into real reading progress.

LUCA listens at the phoneme level. Every sound. Every session. Personalized stories your child actually wants to read.

U.S. Patent No. 12,394,332 B2 · NSF SBIR Grant Recipient · Carnegie Mellon Partnership

Free to try · No account needed · View pricing · ESA eligible